PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OPUNC04G19690.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family G2-like
Protein Properties Length: 309aa    MW: 32858.5 Da    PI: 8.7662
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OPUNC04G19690.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like97.21.2e-303083255
          G2-like  2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
                     prlrWt eLH +Fv+a+e LGG++kAtPk il+lm+vkgLt++hvkSHLQ+YR 
  OPUNC04G19690.1 30 PRLRWTGELHCSFVQAIEFLGGQDKATPKLILQLMGVKGLTISHVKSHLQMYRC 83
                     8****************************************************6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.607.8E-292684IPR009057Homeodomain-like
SuperFamilySSF466891.54E-152883IPR009057Homeodomain-like
TIGRFAMsTIGR015572.1E-233083IPR006447Myb domain, plants
PfamPF002492.0E-63182IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 309 aa     Download sequence    Send to blast
MGSGGGGGGG GGGGCGRNGA VRQYIRSKVP RLRWTGELHC SFVQAIEFLG GQDKATPKLI  60
LQLMGVKGLT ISHVKSHLQM YRCSRLGSHG TGRRSEMQPQ LQRKHSCGAD EQVPREFLCP  120
PLKRTRMGTE ATYKGMQGSQ GISEMRTTGT QYCIDDYMQA MAMERRIKEE GLRWQRDAAA  180
ADGGAAASNL QTVGCSVQES DPFKIIRPEV HHLGPVLKLQ CSKLESSGFI SSSTGPAARD  240
QPKLPPEKCS LSLSLGPDPK CMPAIASSLS ESSCILSSSS RSFSDCSGNS GCLVAPGVNL  300
ELSMSICGS
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1018490.0AK101849.1 Oryza sativa Japonica Group cDNA clone:J033069K05, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015634437.11e-180PREDICTED: putative Myb family transcription factor At1g14600
TrEMBLA0A0E0KU180.0A0A0E0KU18_ORYPU; Uncharacterized protein
STRINGLOC_Os04g47890.11e-180(Oryza sativa Japonica Group)
STRINGORGLA04G0189700.11e-180(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP29663583
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G14600.16e-29G2-like family protein